TA331340 NKAP antibody

Rabbit Polyclonal Anti-NKAP Antibody

See related secondary antibodies

Search for all "NKAP"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish NKAP

Product Description for NKAP

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish NKAP.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for NKAP

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms NF-kappa-B-activating protein
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ye, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8N5F7
Immunogen:
The immunogen for Anti-NKAP antibody is: synthetic peptide directed towards the C-terminal region of Human NKAP. Synthetic peptide located within the following region: EAVRLRKENQIYSADEKRALASFNQEERRKRENKILASFREMVYRKTKGK.
GeneID:
79576
Application WB
Background This gene encodes a protein that is involved in the activation of the ubiquitous transcription factor NF-kappaB. This protein is associated with the the histone deacetylase HDAC3 and with the Notch corepressor complex, and it thereby acts as a transcriptiol repressor of Notch target genes. It is also required for alphabeta T cell development. A related pseudogene has been identified on chromosome X, while a related and intronless retrocopy, which has an intact CDS and may be functiol, is located on chromosome 6.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for NKAP (2 products)

Catalog No. Species Pres. Purity   Source  

NKAP

NKAP Human Purified
  Abnova Taiwan Corp.

NKAP

NKAP Human Purified
  Abnova Taiwan Corp.

Positive controls for NKAP (1 products)

Catalog No. Species Pres. Purity   Source  

NKAP Lysate

Western Blot: NKAP Lysate [NBL1-13651] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for NKAP
  Novus Biologicals Inc.
  • LinkedIn