TA331353 RABGAP1L antibody

Rabbit Polyclonal Anti-RABGAP1L Antibody

See related secondary antibodies

Search for all "RABGAP1L"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat RABGAP1L

Product Description for RABGAP1L

Rabbit anti Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat RABGAP1L.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for RABGAP1L

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms KIAA0471, Rab GTPase-activating protein 1-like, TBC1D18
Presentation Purified
Reactivity Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q5R372
Immunogen:
The immunogen for Anti-RABGAP1L antibody is: synthetic peptide directed towards the middle region of Human RABGAP1L. Synthetic peptide located within the following region: EVVSLQRESDKEEPVTPTSGGGPMSPQDDEAEEESDNELSSGTGDVSKDC.
GeneID:
9910
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for RABGAP1L (2 products)

Catalog No. Species Pres. Purity   Source  

RABGAP1L

RABGAP1L Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

RABGAP1L

RABGAP1L Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.
  • LinkedIn