TA331356 SEC31B antibody

Rabbit Polyclonal Anti-SEC31B Antibody

See related secondary antibodies

Search for all "SEC31B"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human SEC31B

Product Description for SEC31B

Rabbit anti Human SEC31B.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for SEC31B

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Protein transport protein Sec31B, SEC31-like protein 2, SEC31-related protein B, SEC31B-1, SEC31L2
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NQW1
Immunogen:
The immunogen for Anti-SEC31B antibody is: synthetic peptide directed towards the middle region of Human SEC31B. Synthetic peptide located within the following region: VGLGESPQPKGNDLNSDRQQAFCSQASKHTTKEASASSAFFDELVPQNMT.
GeneID:
25956
Application WB
Background This gene encodes a protein of unknown function. The protein has moderate similarity to rat VAP1 protein which is an endosomal membrane-associated protein, containing a putative Ca2+/calmodulin-dependent kise II phosphorylation site.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for SEC31B (3 products)

Catalog No. Species Pres. Purity   Source  

SEC31B

SEC31B Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €788.00
  OriGene Technologies, Inc.

SEC31B

SEC31B Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

SEC31B

SEC31B Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for SEC31B (1 products)

Catalog No. Species Pres. Purity   Source  

SEC31B Lysate

Western Blot: SEC31B Lysate [NBL1-15784] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for SEC31B.
  Novus Biologicals Inc.
  • LinkedIn