TA331357 SHC4 / SHCD antibody

Rabbit Polyclonal Anti-SHC4 Antibody

See related secondary antibodies

Search for all "SHC4 / SHCD"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human SHC4 / SHCD

Product Description for SHC4 / SHCD

Rabbit anti Human SHC4 / SHCD.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for SHC4 / SHCD

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms RALP, Rai-like protein, SHC-transforming protein 4, SHC-transforming protein D, Src homology 2 domain-containing-transforming protein C4
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6S5L8
Immunogen:
The immunogen for Anti-SHC4 antibody is: synthetic peptide directed towards the N-terminal region of Human SHC4. Synthetic peptide located within the following region: NPATLLSLKNFCLGTKEVPRLKLQESRDPGSSGPSSPETSLSRSGTAPPP.
GeneID:
399694
Application WB
Background SHC4 activates both Ras-dependent and Ras-independent migratory pathways in melanomas. It contributes to the early phases of agrin-induced tyrosine phosphorylation of CHRNB1.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for SHC4 / SHCD (3 products)

Catalog No. Species Pres. Purity   Source  

SHC4 / SHCD

SHC4 / SHCD Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

SHC4 / SHCD

SHC4 / SHCD Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

SHC4 / SHCD

SHC4 / SHCD Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for SHC4 / SHCD (3 products)

Catalog No. Species Pres. Purity   Source  

SHC4 293T Cell Transient Overexpression Lysate(Denatured)

SHC4 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

SHC4 Lysate

Western Blot: SHC4 Lysate [NBL1-15937] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for SHC4
  Novus Biologicals Inc.

SHC4 overexpression lysate

SHC4 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn