TA331358 SLC35B2 / PAPST1 antibody

Rabbit Polyclonal Anti-SLC35B2 Antibody

See related secondary antibodies

Search for all "SLC35B2 / PAPST1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rat SLC35B2 / PAPST1

Product Description for SLC35B2 / PAPST1

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rat SLC35B2 / PAPST1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for SLC35B2 / PAPST1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Adenosine 3'-phospho 5'-phosphosulfate transporter 1, PAPS transporter 1, Putative MAPK-activating protein PM15, Putative NF-kappa-B-activating protein 48, Solute carrier family 35 member B2
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8TB61
Immunogen:
The immunogen for Anti-SLC35B2 antibody is: synthetic peptide directed towards the C-terminal region of Human SLC35B2. Synthetic peptide located within the following region: CLLYGHTVTVVGGLGVAVVFAALLLRVYARGRLKQRGKKAVPVESPVQKV.
GeneID:
347734
Application WB
Background Sulfotransferases use an activated form of sulfate, 3-prime-phosphoadenosine 5-prime-phosphosulfate (PAPS), as a common sulfate donor for sulfation of glycoproteins, proteoglycans, and glycolipids in the endoplasmic reticulum and Golgi apparatus. SLC35B2 is located in the microsomal membrane and transports PAPS from the cytosol, where it is synthesized, into the Golgi lumen.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for SLC35B2 / PAPST1 (4 products)

Catalog No. Species Pres. Purity   Source  

SLC35B2 / PAPST1

SLC35B2 / PAPST1 Human Purified
  Abnova Taiwan Corp.

SLC35B2 / PAPST1

SLC35B2 / PAPST1 Human Purified
  Abnova Taiwan Corp.

SLC35B2 / PAPST1

SLC35B2 / PAPST1 Human
  Abnova Taiwan Corp.

SLC35B2 / PAPST1

SLC35B2 / PAPST1 Human
  Abnova Taiwan Corp.

Positive controls for SLC35B2 / PAPST1 (1 products)

Catalog No. Species Pres. Purity   Source  

SLC35B2 overexpression lysate

SLC35B2 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn