TA331359 Spindlin 2A / SPIN2A antibody

Rabbit Polyclonal Anti-SPIN2A Antibody

See related secondary antibodies

Search for all "Spindlin 2A / SPIN2A"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Porcine, Rabbit, Rat Spindlin 2A / SPIN2A

Product Description for Spindlin 2A / SPIN2A

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Porcine, Rabbit, Rat Spindlin 2A / SPIN2A.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Spindlin 2A / SPIN2A

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms DXF34, SPIN-2, SPIN-2A, SPIN2, Spindlin-2A, Spindlin-like protein 2A
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q99865
Immunogen:
The immunogen for Anti-SPIN2A antibody is: synthetic peptide directed towards the N-terminal region of Human SPIN2A. Synthetic peptide located within the following region: MTKKKVSQKKQRGRPSSQPCRNIVGCRISHGWKEGDEPITQWKGTVLDQV.
GeneID:
54466
Application WB
Background This gene encodes one of three members of the DXF34 gene family, located in a 100-kb region of chromosome Xp11.21.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Spindlin 2A / SPIN2A (3 products)

Catalog No. Species Pres. Purity   Source  

Spindlin 2A / SPIN2A

Spindlin 2A / SPIN2A Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Spindlin 2A / SPIN2A

Spindlin 2A / SPIN2A Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Spindlin 2A / SPIN2A

Spindlin 2A / SPIN2A Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for Spindlin 2A / SPIN2A (1 products)

Catalog No. Species Pres. Purity   Source  

SPIN2A Lysate

Western Blot: SPIN2A Lysate [NBL1-16402] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for SPIN2A
  Novus Biologicals Inc.
  • LinkedIn