TA331360 SPSB1 antibody

Rabbit Polyclonal Anti-SPSB1 Antibody

See related secondary antibodies

Search for all "SPSB1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish SPSB1

Product Description for SPSB1

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish SPSB1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for SPSB1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms SPRY domain-containing SOCS box protein 1, SSB-1, SSB1
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96BD6
Immunogen:
The immunogen for Anti-SPSB1 antibody is: synthetic peptide directed towards the middle region of Human SPSB1. Synthetic peptide located within the following region: RGLHVWQITWAMRQRGTHAVVGVATADAPLHSVGYTTLVGNNHESWGWDL.
GeneID:
80176
Application WB
Background SPSB1 is a probable substrate recognition component of a SCF-like ECS (Elongin BC-CUL2/5-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitition and subsequent proteasomal degradation of target proteins.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for SPSB1 (5 products)

Catalog No. Species Pres. Purity   Source  

SPSB1

SPSB1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

SPSB1 (24-233, His-tag)

SPSB1 Human Purified > 90 % E. coli
0.25 mg / €1,070.00
  OriGene Technologies GmbH

SPSB1 (24-233, His-tag)

SPSB1 Human Purified > 90 % E. coli
50 µg / €400.00
  OriGene Technologies GmbH

SPSB1

SPSB1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

SPSB1

SPSB1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for SPSB1 (1 products)

Catalog No. Species Pres. Purity   Source  

SPSB1 Lysate

Western Blot: SPSB1 Lysate [NBL1-16438] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for SPSB1
  Novus Biologicals Inc.
  • LinkedIn