TA331368 DEADC1 antibody

Rabbit Polyclonal Anti-ADAT2 Antibody

See related secondary antibodies

Search for all "DEADC1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish DEADC1

Product Description for DEADC1

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish DEADC1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for DEADC1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms ADAT2, DKFZp686L1118, Deaminase domain-containing protein 1, TAD2, tRNA-specific adenosine deaminase 2, tRNA-specific adenosine-34 deaminase subunit ADAT2
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q7Z6V5
Immunogen:
The immunogen for Anti-ADAT2 antibody is: synthetic peptide directed towards the C-terminal region of Human ADAT2. Synthetic peptide located within the following region: NIASADLPNTGRPFQCIPGYRAEEAVEMLKTFYKQENPNAPKSKVRKKEC.
GeneID:
134637
Application WB
Background ADAT2 is probably participates in deamition of adenosine-34 to inosine in many tRs.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for DEADC1 (8 products)

Catalog No. Species Pres. Purity   Source  

DEADC1

DEADC1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

DEADC1 (1-191, His-tag)

DEADC1 Human Purified > 90 % by SDS - PAGE E. coli
0.25 mg / €1,070.00
  OriGene Technologies GmbH

DEADC1 (1-191, His-tag)

DEADC1 Human Purified > 90 % by SDS - PAGE E. coli
50 µg / €400.00
  OriGene Technologies GmbH

DEADC1

DEADC1 Human Purified
  Abnova Taiwan Corp.

DEADC1

DEADC1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

DEADC1

DEADC1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

DEADC1

DEADC1 Human Purified
  Novus Biologicals Inc.

DEADC1

DEADC1 Human Purified
  Novus Biologicals Inc.

Positive controls for DEADC1 (1 products)

Catalog No. Species Pres. Purity   Source  

ADAT2 overexpression lysate

ADAT2 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn