TA331370 ANKFY1 antibody

Rabbit Polyclonal Anti-ANKFY1 Antibody

See related secondary antibodies

Search for all "ANKFY1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human ANKFY1

Product Description for ANKFY1

Rabbit anti Human ANKFY1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ANKFY1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms ANKHZN, Ankyrin repeat and FYVE domain-containing protein 1, KIAA1255
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9P2R3
Immunogen:
The immunogen for Anti-ANKFY1 antibody is: synthetic peptide directed towards the C-terminal region of Human ANKFY1. Synthetic peptide located within the following region: VNGTSFDENSFAARLIQRGSHTDAPDTATGKARASRRGDAGVCRRQEMAC.
GeneID:
51479
Application WB
Background This gene encodes a cytoplasmic protein that contains a coiled-coil structure and a BTB/POZ domain at its N-terminus, ankyrin repeats in the middle portion, and a FYVE-finger motif at its C-terminus. This protein belongs to a subgroup of double zinc finger proteins which may be involved in vesicle or protein transport. Alterte splicing results in multiple transcript variants of this gene.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for ANKFY1 (1 products)

Catalog No. Species Pres. Purity   Source  

ANKFY1 293T Cell Transient Overexpression Lysate(Denatured)

ANKFY1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn