TA331376 C2orf71 antibody

Rabbit Polyclonal Anti-C2orf71 Antibody

See related secondary antibodies

Search for all "C2orf71"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Guinea Pig, Human, Rabbit, Zebrafish C2orf71

Product Description for C2orf71

Rabbit anti Bovine, Guinea Pig, Human, Rabbit, Zebrafish C2orf71.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for C2orf71

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Purified
Reactivity Bov, GP, Hu, Rb, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
A6NGG8
Immunogen:
The immunogen for Anti-C2orf71 antibody is: synthetic peptide directed towards the C-terminal region of Human C2orf71. Synthetic peptide located within the following region: SPCSPELQGGTRRASPPEFCVLGHGLQPEPRTGHIQDKSQPEAQPQQEEV.
GeneID:
388939
Application WB
Background The protein encoded by this gene is highly expressed in photoreceptors and may associate with the primary cilium of the outer segment. The encoded protein appears to undergo post-translatiol lipid modification. Nonsense and missense variants of this gene appear to cause a recessive form of retinitis pigmentosa.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for C2orf71 (1 products)

Catalog No. Species Pres. Purity   Source  

C2orf71 overexpression lysate

C2orf71 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn