TA331379 NOL4L antibody

Rabbit Polyclonal Anti-C20orf112 Antibody

See related secondary antibodies

Search for all "NOL4L"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat NOL4L

Product Description for NOL4L

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat NOL4L.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for NOL4L

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms C20orf112, C20orf113, Nucleolar protein 4-like
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96MY1
Immunogen:
The immunogen for Anti-C20orf112 antibody is: synthetic peptide directed towards the N-terminal region of Human C20orf112. Synthetic peptide located within the following region: LRVMNSQEQDETSVSSEDFDMSDSTWMSADPHLASSLSPSQDERMRSPQN.
GeneID:
140688
Application WB
Background The function of this protein remains unknown.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for NOL4L (1 products)

Catalog No. Species Pres. Purity   Source  

NOL4L

NOL4L Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Positive controls for NOL4L (1 products)

Catalog No. Species Pres. Purity   Source  

NOL4L overexpression lysate

NOL4L overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn