TA331380 CBARA1 antibody

Rabbit Polyclonal Anti-MICU1 Antibody

See related secondary antibodies

Search for all "CBARA1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Goat, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish CBARA1

Product Description for CBARA1

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Goat, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish CBARA1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for CBARA1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Atopy-related autoantigen CALC, CALC, Calcium-binding atopy-related autoantigen 1, Hom s 4
Presentation Purified
Reactivity Bov, Can, Eq, GP, Gt, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9BPX6
Immunogen:
The immunogen for Anti-MICU1 antibody is: synthetic peptide directed towards the C-terminal region of Human MICU1. Synthetic peptide located within the following region: LSDHVCDVVFALFDCDGNGELSNKEFVSIMKQRLMRGLEKPKDMGFTRLM.
GeneID:
10367
Application WB
Background MICU1 is a key regulator of mitochondrial calcium uptake required for calcium entry into mitochondrion. It may act as a calcium sensor via its EF-hand domains, gating the activity of a calcium channel partner. MICU1 induces T-helper 1-mediated autoreactivity, which is accompanied by the release of IFNG.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for CBARA1 (6 products)

Catalog No. Species Pres. Purity   Source  

CBARA1

CBARA1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

CBARA1 (full length, N-term HIS tag, transcript variant 1)

CBARA1 Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €205.00
  OriGene Technologies, Inc.

CBARA1

CBARA1 Human Purified
  Abnova Taiwan Corp.

CBARA1

CBARA1 Human Purified
  Abnova Taiwan Corp.

CBARA1

CBARA1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

CBARA1

CBARA1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.
  • LinkedIn