TA331383 CHID1 / SI-CLP antibody

Rabbit Polyclonal Anti-CHID1 Antibody

See related secondary antibodies

Search for all "CHID1 / SI-CLP"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat CHID1 / SI-CLP

Product Description for CHID1 / SI-CLP

Rabbit anti Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat CHID1 / SI-CLP.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for CHID1 / SI-CLP

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Chitinase domain-containing protein 1, GL008, PSEC0104, SB139, Stabilin-1-interacting chitinase-like protein
Presentation Purified
Reactivity Can, Eq, GP, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9BWS9
Immunogen:
The immunogen for Anti-CHID1 antibody is: synthetic peptide directed towards the N-terminal region of Human CHID1. Synthetic peptide located within the following region: CSPVHTTLSKSDAKKAASKTLLEKSQFSDKPVQDRGLVVTDLKAESVVLE.
GeneID:
66005
Application WB
Background CHID1 is a saccharide- and LPS-binding protein with possible roles in pathogen sensing and endotoxin neutralization. Ligand-binding specificity relates to the length of the oligosaccharides, with preference for chitotetraose (in vitro).
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for CHID1 / SI-CLP (2 products)

Catalog No. Species Pres. Purity   Source  

CHID1 / SI-CLP

CHID1 / SI-CLP Human Purified
  Abnova Taiwan Corp.

CHID1 / SI-CLP

CHID1 / SI-CLP Human Purified
  Abnova Taiwan Corp.

Positive controls for CHID1 / SI-CLP (5 products)

Catalog No. Species Pres. Purity   Source  

CHID1 Lysate

Western Blot: CHID1 Lysate [NBL1-09155] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for CHID1
  Novus Biologicals Inc.

CHID1 overexpression lysate

CHID1 overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.

CHID1 overexpression lysate

CHID1 overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.

CHID1 overexpression lysate

CHID1 overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.

CHID1 overexpression lysate

CHID1 overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.
  • LinkedIn