TA331391 DACT3 antibody

Rabbit Polyclonal Anti-DACT3 Antibody

See related secondary antibodies

Search for all "DACT3"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human, Mouse, Porcine, Rat DACT3

Product Description for DACT3

Rabbit anti Human, Mouse, Porcine, Rat DACT3.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for DACT3

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms DAPPER3, RRR1, antagonist of beta-catenin dapper homolog 3, arginine-rich region 1 protein, dapper homolog 3
Presentation Purified
Reactivity Hu, Ms, Por, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96B18
Immunogen:
The immunogen for Anti-DACT3 antibody is: synthetic peptide directed towards the C-terminal region of Human DACT3. Synthetic peptide located within the following region: AAGRRGRMAEASGRRGSPRARKASRSQSETSLLGRASAVPSGPPKYPTAE.
GeneID:
147906
Application WB
Background The function of this protein remains unknown.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for DACT3 (2 products)

Catalog No. Species Pres. Purity   Source  

DACT3 Lysate

Western Blot: Dact3 Lysate [NBL1-09712] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for DACT3.
  Novus Biologicals Inc.

DACT3 overexpression lysate

DACT3 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn