TA331399 C14orf80 antibody

Rabbit polyclonal Anti-C14orf80 Antibody

See related secondary antibodies

Search for all "C14orf80"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Equine, Guinea Pig, Human, Rat C14orf80

Product Description for C14orf80

Rabbit anti Bovine, Equine, Guinea Pig, Human, Rat C14orf80.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for C14orf80

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Uncharacterized protein C14orf80
Presentation Purified
Reactivity Bov, Eq, GP, Hu, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q86SX3
Immunogen:
The immunogen for anti-C14orf80 antibody: synthetic peptide directed towards the n terminal of human C14orf80. Synthetic peptide located within the following region: MLAQARVPLGDEMTVCQIHLYTRGCHSDQSLSHLSVTEAEMLRDPEGGQQ.
GeneID:
283643
Application WB
Background The specific function of C14orf80 is not yet known.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for C14orf80 (3 products)

Catalog No. Species Pres. Purity   Source  

C14orf80 overexpression lysate

C14orf80 overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.

C14orf80 overexpression lysate

C14orf80 overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.

C14orf80 overexpression lysate

C14orf80 overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.
  • LinkedIn