TA331402 Hexosaminidase D antibody

Rabbit polyclonal Anti-HEXDC Antibody

See related secondary antibodies

Search for all "Hexosaminidase D"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human Hexosaminidase D

Product Description for Hexosaminidase D

Rabbit anti Human Hexosaminidase D.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Hexosaminidase D

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Beta-N-acetylhexosaminidase, Beta-hexosaminidase D, HEXDC, Hexosaminidase domain-containing protein, N-acetyl-beta-galactosaminidase
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8WVB3
Immunogen:
The immunogen for anti-HEXDC antibody: synthetic peptide directed towards the middle region of human HEXDC. Synthetic peptide located within the following region: CQMAWAIRAHVGVVPSGPAVSCPHSVPEGPGQPLGERLENTEGSSTGRPA.
GeneID:
284004
Application WB
Background HEXDC has hexosaminidase activity.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Hexosaminidase D (2 products)

Catalog No. Species Pres. Purity   Source  

Hexosaminidase D

Hexosaminidase D Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Hexosaminidase D

Hexosaminidase D Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for Hexosaminidase D (3 products)

Catalog No. Species Pres. Purity   Source  

HEXDC 293T Cell Transient Overexpression Lysate(Denatured)

HEXDC 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

HEXDC Lysate

Western Blot: HEXDC Lysate [NBL1-11517] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for HEXDC
  Novus Biologicals Inc.

HEXDC overexpression lysate

HEXDC overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn