TA331413 Taperin antibody

Rabbit polyclonal Anti-C9orf75 Antibody

See related secondary antibodies

Search for all "Taperin"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rat Taperin

Product Description for Taperin

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rat Taperin.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Taperin

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms C9orf75, TPRN
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q4KMQ1
Immunogen:
The immunogen for anti-C9orf75 antibody: synthetic peptide directed towards the middle region of human C9orf75. Synthetic peptide located within the following region: EAMVRCGGVERWGESDTRASPCVHILSSHFQLTPASQNDLSDFRSEPALY.
GeneID:
286262
Application WB
Background The specific function of C9orf75 is not yet known.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn