TA331414 Mpv17-like protein / MPV17L antibody

Rabbit polyclonal Anti-MPV17L Antibody

See related secondary antibodies

Search for all "Mpv17-like protein / MPV17L"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Guinea Pig, Human Mpv17-like protein / MPV17L

Product Description for Mpv17-like protein / MPV17L

Rabbit anti Guinea Pig, Human Mpv17-like protein / MPV17L.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Mpv17-like protein / MPV17L

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms M-LP homolog, M-LPH
Presentation Purified
Reactivity GP, Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q2QL34
Immunogen:
The immunogen for anti-MPV17L antibody: synthetic peptide directed towards the N terminal of human MPV17L. Synthetic peptide located within the following region: MAGWWPALSRAARRHPWPTNVLLYGSLVSAGDALQQRLQGREANWRQTRR.
GeneID:
255027
Application WB
Background Isoform 1 participates in reactive oxygen species metablism by up- or down-regulation of the genes of antioxidant enzymes.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for Mpv17-like protein / MPV17L (2 products)

Catalog No. Species Pres. Purity   Source  

MPV17L Lysate

Western Blot: MPV17L Lysate [NBL1-13212] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for MPV17L
  Novus Biologicals Inc.

MPV17L overexpression lysate

MPV17L overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn