TA331420 COX18 antibody

Rabbit polyclonal Anti-COX18 Antibody

See related secondary antibodies

Search for all "COX18"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat COX18

Product Description for COX18

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat COX18.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for COX18

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms COX-18, COX18Hs, Cytochrome c oxidase assembly protein 18, Mitochondrial inner membrane protein COX18, OXA1L2
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8N8Q8
Immunogen:
The immunogen for anti-COX18 antibody: synthetic peptide directed towards the middle region of human COX18. Synthetic peptide located within the following region: LVWIQLPMWIFMSFALRNLSTGAAHSEGFSVQEQLATGGILWFPDLTAPD.
GeneID:
285521
Application WB
Background COX18 is required for the insertion of integral membrane proteins into the mitochondrial inner membrane. COX18 is essential for the activity and assembly of cytochrome c oxidase. COX18 plays a central role in the translocation and export of the C-termil part of the COX2 protein into the mitochondrial intermembrane space.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for COX18 (2 products)

Catalog No. Species Pres. Purity   Source  

COX18

COX18 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

COX18

COX18 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for COX18 (1 products)

Catalog No. Species Pres. Purity   Source  

COX18 overexpression lysate

COX18 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn