TA331438 MAFA antibody

Rabbit polyclonal Anti-Mafa Antibody

See related secondary antibodies

Search for all "MAFA"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human, Mouse, Rat MAFA

Product Description for MAFA

Rabbit anti Human, Mouse, Rat MAFA.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for MAFA

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Pancreatic beta-cell-specific transcriptional activator, Transcription factor MafA, Transcription factor RIPE3b1, V-maf musculoaponeurotic fibrosarcoma oncogene homolog A
Presentation Purified
Reactivity Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8CF90
Immunogen:
The immunogen for anti-Mafa antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: KLEVGRLAKERDLYKEKYEKLAGRGGPGGAGGAGFPREPSPAQAGPGAAK.
GeneID:
378435
Application WB
Background Mafa acts as a transcriptiol factor. Mafa specifically binds the insulin enhancer element RIPE3b. Mafa cooperates synergistically with NEUROD1 and PDX1. Phosphorylation by GSK3 increases its transcriptiol activity and is required for its oncogenic activity. Mafa regulates the insulin gene transcription. Mafa is involved either as an oncogene or as a tumor suppressor, depending on the cell context.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn