TA331448 FAM172A antibody

Rabbit polyclonal Anti-Fam172a Antibody

See related secondary antibodies

Search for all "FAM172A"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Mouse FAM172A

Product Description for FAM172A

Rabbit anti Mouse FAM172A.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for FAM172A

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms 1110033M05RIK, UPF0528 protein FAM172A
Presentation Purified
Reactivity Ms
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q3TNH5
Immunogen:
The immunogen for anti-Fam172a antibody: synthetic peptide directed towards the n terminal of mouse 1110033M05Rik. Synthetic peptide located within the following region: NLVGARILREKVRARAQGSSPRDLEGHASSHLPSQHCSWGQSSDLLSRID.
GeneID:
68675
Application WB
Background The amino acid sequence of 1110033M05Rik is derived from an annotated genomic sequence (NT_039589) using gene prediction method: GNOMON, supported by mR and EST evidence.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn