TA331451 Glypican-3 / GPC3 antibody

Rabbit polyclonal Anti-GPC3 Antibody

See related secondary antibodies

Search for all "Glypican-3 / GPC3"

0.1 ml / €300.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat Glypican-3 / GPC3

TA331451

More Views

  • TA331451

Product Description for Glypican-3 / GPC3

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat Glypican-3 / GPC3.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Glypican-3 / GPC3

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms GTR2-2, Intestinal protein OCI-5, MXR7, OCI5
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P51654
Immunogen:
The immunogen for anti-GPC3 antibody: synthetic peptide directed towards the middle region of human GPC3. Synthetic peptide located within the following region: FSTIHDSIQYVQKNAGKLTTTIGKLCAHSQQRQYRSAYYPEDLFIDKKVL.
GeneID:
2719
Application WB
Background Cell surface heparan sulfate proteoglycans are composed of a membrane-associated protein core substituted with a variable number of heparan sulfate chains. Members of the glypican-related integral membrane proteoglycan family (GRIPS) contain a core protein anchored to the cytoplasmic membrane via a glycosyl phosphatidylinositol linkage. These proteins may play a role in the control of cell division and growth regulation. Deletion mutations in this gene are associated with Simpson-Golabi-Behmel syndrome.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Glypican-3 / GPC3 (4 products)

Catalog No. Species Pres. Purity   Source  

Glypican-3 / GPC3

Glypican-3 / GPC3 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Glypican-3 / GPC3

Glypican-3 / GPC3 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Glypican-3 / GPC3

Glypican-3 / GPC3 Human 12.5% SDS-PAGE Stained with Coomassie Blue
  Abnova Taiwan Corp.

Glypican-3 / GPC3

Glypican-3 / GPC3 Human 12.5% SDS-PAGE Stained with Coomassie Blue
  Abnova Taiwan Corp.
  • LinkedIn