TA331452 CACNG1 antibody

Rabbit polyclonal Anti-CACNG1 Antibody

See related secondary antibodies

Search for all "CACNG1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat CACNG1

TA331452

More Views

  • TA331452

Product Description for CACNG1

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat CACNG1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for CACNG1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms CACNLG, Dihydropyridine-sensitive L-type skeletal muscle calcium channel subunit gamma, Voltage-dependent calcium channel gamma-1 subunit
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q06432
Immunogen:
The immunogen for anti-CACNG1 antibody: synthetic peptide directed towards the N terminal of human CACNG1. Synthetic peptide located within the following region: SKTCGPITLPGEKNCSYFRHFNPGESSEIFEFTTQKEYSISAAAIAIFSL.
GeneID:
786
Application WB
Background L-type calcium channels are composed of five subunits. The protein encoded by this gene represents one of these subunits, gamma, and is one of several gamma subunit proteins. This particular gamma subunit is part of skeletal muscle 1,4-dihydropyridine-sensitive calcium channels and is an integral membrane protein that plays a role in excitation-contraction coupling. This gene is a member of the neurol calcium channel gamma subunit gene subfamily of the PMP-22/EMP/MP20 family and is located in a cluster with two similar gamma subunit-encoding genes.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for CACNG1 (1 products)

Catalog No. Species Pres. Purity   Source  

CACNG1 293T Cell Transient Overexpression Lysate(Denatured)

CACNG1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn