TA331455 KCNMA1 antibody

Rabbit polyclonal Anti-KCNMA1 Antibody

See related secondary antibodies

Search for all "KCNMA1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish KCNMA1

Product Description for KCNMA1

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish KCNMA1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for KCNMA1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms BK, BKCA channel, Calcium-activated potassium channel subunit alpha-1, K VCA, Maxi K, Slo-alpha, Slo1, Slowpoke homolog, hSlo
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Sh, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q12791
Immunogen:
The immunogen for anti-KCNMA1 antibody: synthetic peptide directed towards the middle region of human KCNMA1. Synthetic peptide located within the following region: ESRSRKRILINPGNHLKIQEGTLGFFIASDAKEVKRAFFYCKACHDDITD.
GeneID:
3778
Application WB
Background This protein is a transcription factor that interacts with specific negative regulatory elements (NREs) to mediate transcriptiol repression of certain NK-kappa-B-responsive genes. The protein localizes predomintly to the nucleolus with a small fraction found in the nucleoplasm and cytoplasm.MaxiK channels are large conductance, voltage and calcium-sensitive potassium channels which are fundamental to the control of smooth muscle tone and neurol excitability. MaxiK channels can be formed by 2 subunits: the pore-forming alpha subunit, which is the product of this gene, and the modulatory beta subunit. Intracellular calcium regulates the physical association between the alpha and beta subunits. Altertively spliced transcript variants encoding different isoforms have been identified.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for KCNMA1 (1 products)

Catalog No. Species Pres. Purity   Source  

Maxi Potassium channel alpha Lysate

Western Blot: Maxi Potassium channel alpha Lysate [NBL1-12189] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for KCNMA1
  Novus Biologicals Inc.
  • LinkedIn