TA331456 KCNAB2 antibody

Rabbit polyclonal Anti-KCNAB2 Antibody

See related secondary antibodies

Search for all "KCNAB2"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish KCNAB2

TA331456

More Views

  • TA331456
  • TA331456
  • TA331456

Product Description for KCNAB2

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish KCNAB2.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for KCNAB2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms HKvbeta2, KCNA2B, KCNK2, Kv-beta-2, Voltage-gated potassium channel subunit beta-2
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt, Ye, Ze
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q13303
Immunogen:
The immunogen for anti-KCNAB2 antibody: synthetic peptide directed towards the middle region of human KCNAB2. Synthetic peptide located within the following region: WGGKAETERGLSRKHIIEGLKASLERLQLEYVDVVFANRPDPNTPMEETV.
GeneID:
8514
Application WB
IHC
Background The functions of Voltage-gated potassium (Kv) channels include regulating neurotransmitter release, heart rate, insulin secretion, neurol excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. KCB2 is a member of the potassium channel, voltage-gated, shaker-related subfamily. This member is one of the beta subunits, which are auxiliary proteins associating with functiol Kv-alpha subunits.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for KCNAB2 (2 products)

Catalog No. Species Pres. Purity   Source  

KCNAB2 (transcript variant 1)

KCNAB2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

KCNAB2 (transcript variant 2)

KCNAB2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.
  • LinkedIn