TA331459 KCNH3 antibody

Rabbit polyclonal Anti-KCNH3 Antibody

See related secondary antibodies

Search for all "KCNH3"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat KCNH3

Product Description for KCNH3

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat KCNH3.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for KCNH3

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms BEC1, Brain-specific eag-like channel 1, ELK channel 2, ELK2, Ether-a-go-go-like potassium channel 2, KCNH3, KIAA1282, Potassium voltage-gated channel subfamily H member 3, Voltage-gated potassium channel subunit Kv12.2
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9ULD8
Immunogen:
The immunogen for anti-KCNH3 antibody: synthetic peptide directed towards the middle region of human KCNH3. Synthetic peptide located within the following region: LYPEFAPRFSRGLRGELSYNLGAGGGSAEVDTSSLSGDNTLMSTLEEKET.
GeneID:
23416
Application WB
Background The exact function of this protein remains unknown.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for KCNH3 (1 products)

Catalog No. Species Pres. Purity   Source  

KCNH3 overexpression lysate

KCNH3 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn