TA331466 SCN3B antibody

Rabbit polyclonal Anti-SCN3B Antibody

See related secondary antibodies

Search for all "SCN3B"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat SCN3B

Product Description for SCN3B

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat SCN3B.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for SCN3B

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms KIAA1158, Sodium channel subunit beta-3
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NY72
Immunogen:
The immunogen for anti-SCN3B antibody: synthetic peptide directed towards the N terminal of human SCN3B. Synthetic peptide located within the following region: RPEGGKDFLIYEYRNGHQEVESPFQGRLQWNGSKDLQDVSITVLNVTLND.
GeneID:
55800
Application WB
Background SCN3B is one member of the sodium channel beta subunits of voltage-gated sodium channels, which are responsible for the generation and propagation of action potentials in neurons and muscle. SCN3B influences the ictivation kinetics of the sodium channel.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for SCN3B (3 products)

Catalog No. Species Pres. Purity   Source  

SCN3B (transcript variant 2)

SCN3B Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

SCN3B (23-159, His-tag)

SCN3B Human Purified > 90 % by SDS - PAGE E. coli
0.25 mg / €1,070.00
  OriGene Technologies GmbH

SCN3B (23-159, His-tag)

SCN3B Human Purified > 90 % by SDS - PAGE E. coli
50 µg / €400.00
  OriGene Technologies GmbH

Positive controls for SCN3B (1 products)

Catalog No. Species Pres. Purity   Source  

SCN3B Lysate

Western Blot: SCN3B Lysate [NBL1-15743] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for SCN3B
  Novus Biologicals Inc.
  • LinkedIn