TA331473 G3BP1 / G3BP antibody

Rabbit polyclonal Anti-G3BP1 Antibody

See related secondary antibodies

Search for all "G3BP1 / G3BP"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat G3BP1 / G3BP

TA331473

More Views

  • TA331473
  • TA331473
  • TA331473

Product Description for G3BP1 / G3BP

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat G3BP1 / G3BP.
Presentation: Purified
Product is tested for Immunoprecipitation, Western blot / Immunoblot.

Properties for G3BP1 / G3BP

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms ATP-dependent DNA helicase VIII, G3BP-1, GAP SH3 domain-binding protein 1, Ras GTPase-activating protein-binding protein 1, hDH VIII
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications IP, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q13283
Immunogen:
The immunogen for anti-G3BP1 antibody: synthetic peptide directed towards the N terminal of human G3BP1. Synthetic peptide located within the following region: RFMQTFVLAPEGSVANKFYVHNDIFRYQDEVFGGFVTEPQEESEEEVEEP.
GeneID:
10146
Application WB
IP
Background This gene encodes one of the D-unwinding enzymes which prefers partially unwound 3'-tailed substrates and can also unwind partial R/D and R/R duplexes in an ATP-dependent fashion. This enzyme is a member of the heterogeneous nuclear R-binding
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for G3BP1 / G3BP (10 products)

Catalog No. Species Pres. Purity   Source  

G3BP1 / G3BP (transcript variant 1)

G3BP1 / G3BP Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

G3BP1 / G3BP (transcript variant 2)

G3BP1 / G3BP Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

G3BP1 / G3BP (1-466, His-tag)

G3BP1 / G3BP Human Purified > 85 % E. coli
0.25 mg / €1,070.00
  OriGene Technologies GmbH

G3BP1 / G3BP (1-466, His-tag)

G3BP1 / G3BP Human Purified > 85 % E. coli
50 µg / €400.00
  OriGene Technologies GmbH

G3BP1 / G3BP

G3BP1 / G3BP Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

G3BP1 / G3BP

G3BP1 / G3BP Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

G3BP1 / G3BP

G3BP1 / G3BP Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

G3BP1 / G3BP

G3BP1 / G3BP Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

G3BP1 / G3BP

G3BP1 / G3BP Human Purified 95 % E. coli
  GenWay Biotech Inc.

G3BP1 / G3BP

G3BP1 / G3BP Human Purified 95 % E. coli
  GenWay Biotech Inc.
  • LinkedIn