TA331482 AIP / XAP2 antibody

Rabbit polyclonal Anti-AIP Antibody

See related secondary antibodies

Search for all "AIP / XAP2"

0.1 ml / €300.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rat, Sheep, Zebrafish AIP / XAP2

Product Description for AIP / XAP2

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rat, Sheep, Zebrafish AIP / XAP2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for AIP / XAP2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms AH receptor-interacting protein, ARA9, Aryl-hydrocarbon receptor-interacting protein, HBV X-associated protein 2, Immunophilin homolog ARA9
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rt, Sh, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O00170
Immunogen:
The immunogen for anti-AIP antibody: synthetic peptide directed towards the N terminal of human AIP. Synthetic peptide located within the following region: PLVAKSLRNIAVGKDPLEGQRHCCGVAQMREHSSLGHADLDALQQNPQPL.
GeneID:
9049
Application WB
Background AIP may play a positive role in AHR-mediated siglling possibly by influencing its receptivity for ligand and/or its nuclear targeting. AIP is the cellular negative regulator of the HBV X protein.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for AIP / XAP2 (6 products)

Catalog No. Species Pres. Purity   Source  

AIP / XAP2

AIP / XAP2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

AIP / XAP2 (1-330, His-tag)

AIP / XAP2 Human Purified > 90 % E. coli
0.5 mg / €820.00
  OriGene Technologies GmbH

AIP / XAP2 (1-330, His-tag)

AIP / XAP2 Human Purified > 90 % E. coli
0.1 mg / €320.00
  OriGene Technologies GmbH

AIP / XAP2

AIP / XAP2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

AIP / XAP2

AIP / XAP2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

AIP / XAP2

AIP / XAP2 Human
  Abnova Taiwan Corp.
  • LinkedIn