TA331491 RNF207 antibody

Rabbit Polyclonal Anti-RNF207 Antibody

See related secondary antibodies

Search for all "RNF207"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat RNF207

Product Description for RNF207

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat RNF207.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for RNF207

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms C1orf188, FLJ46380, RING finger protein 207
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6ZRF8
Immunogen:
The immunogen for Anti-RNF207 Antibody: synthetic peptide directed towards the N terminal of human RNF207. Synthetic peptide located within the following region: CLLDCFHDFCAGCLRGRATDGRLTCPLCQHQTVLKGPSGLPPVDRLLQFL.
GeneID:
388591
Application WB
Background RNF207 contains 1 B box-type zinc finger and 1 RING-type zinc finger. The function of the RNF207 protein remains unknown.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for RNF207 (4 products)

Catalog No. Species Pres. Purity   Source  

RNF207

RNF207 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

RNF207

RNF207 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

RNF207

RNF207 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

RNF207

RNF207 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for RNF207 (1 products)

Catalog No. Species Pres. Purity   Source  

RNF207 overexpression lysate

RNF207 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn