TA331505 ZRANB2 antibody

Rabbit Polyclonal Anti-ZNF265 Antibody

See related secondary antibodies

Search for all "ZRANB2"

0.1 ml / €300.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish ZRANB2

Product Description for ZRANB2

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish ZRANB2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ZRANB2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms ZIS, ZNF265, Zinc finger Ran-binding domain-containing protein 2, Zinc finger protein 265, Zinc finger splicing
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O95218
Immunogen:
The immunogen for Anti-ZNF265 Antibody: synthetic peptide directed towards the N terminal of human ZNF265. Synthetic peptide located within the following region: RCGREKTTEAKMMKAGGTEIGKTLAEKSRGLFSANDWQCKTCSNVNWARR.
GeneID:
9406
Application WB
Background ZNF265 is a protein that has been shown to bind to the spliceosomal components U1-70K and U2AF35 and to direct altertive splicing. Alysis of the structure reveals substantial similarity to known R-binding motifs in terms of the distribution of key surface residues responsible for making R contacts, despite a complete lack of structural homology. An R gel shift assay was used to demonstrate that a single crossed finger domain from ZNF265 is capable of binding to an R message. Taken together, these results define a new R-binding motif and should provide insight into the functions of the >100 uncharacterized proteins in the sequence data bases that contain this domain.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ZRANB2 (4 products)

Catalog No. Species Pres. Purity   Source  

ZRANB2

ZRANB2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

ZRANB2

ZRANB2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

ZRANB2

ZRANB2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

ZRANB2

ZRANB2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for ZRANB2 (3 products)

Catalog No. Species Pres. Purity   Source  

ZRANB2 Lysate

Western Blot: ZRANB2 Lysate [NBL1-18266] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for ZRANB2.
  Novus Biologicals Inc.

ZRANB2 overexpression lysate

ZRANB2 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

ZRANB2 overexpression lysate

ZRANB2 overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.
  • LinkedIn