TA331507 ARHGAP11A antibody

Rabbit Polyclonal Anti-ARHGAP11A Antibody

See related secondary antibodies

Search for all "ARHGAP11A"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat ARHGAP11A

Product Description for ARHGAP11A

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat ARHGAP11A.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ARHGAP11A

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms KIAA0013, Rho GTPase-activating protein 11A, Rho-type GTPase-activating protein 11A
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6P4F7
Immunogen:
The immunogen for Anti-ARHGAP11A Antibody is: synthetic peptide directed towards the N-terminal region of Human ARHGAP11A. Synthetic peptide located within the following region: MLGIDGLCATPSLEGFEEGEYETPGEYKRKRRQSVGDFVSGALNKFKPNR.
GeneID:
9824
Application WB
Background The function of this protein remains unknown.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn