TA331518 Brorin / VWC2 antibody

Rabbit Polyclonal Anti-VWC2 Antibody

See related secondary antibodies

Search for all "Brorin / VWC2"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish Brorin / VWC2

Product Description for Brorin / VWC2

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish Brorin / VWC2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Brorin / VWC2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Brain-specific chordin-like protein, von Willebrand factor C domain-containing protein 2
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q2TAL6
Immunogen:
The immunogen for Anti-VWC2 Antibody is: synthetic peptide directed towards the middle region of Human VWC2. Synthetic peptide located within the following region: YVYPDYRGKGCVDESGFVYAIGEKFAPGPSACPCLCTEEGPLCAQPECPR.
GeneID:
375567
Application WB
Background This gene encodes a secreted bone morphogenic protein antagonist. The encoded protein is possibly involved in neural function and development and may have a role in cell adhesion.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn