TA331524 PRSS55 antibody

Rabbit Polyclonal Anti-PRSS55 Antibody

See related secondary antibodies

Search for all "PRSS55"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rat PRSS55

Product Description for PRSS55

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rat PRSS55.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for PRSS55

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Serine protease 55, T-SP1, TSP1, Testis serine protease 1
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6UWB4
Immunogen:
The immunogen for Anti-PRSS55 Antibody is: synthetic peptide directed towards the C-terminal region of Human PRSS55. Synthetic peptide located within the following region: SKMFPKLTKNMLCAGYKNESYDACKGDSGGPLVCTPEPGEKWYQVGIISW.
GeneID:
203074
Application WB
Background This gene encodes a member of a group of membrane-anchored chymotrypsin (S1)-like serine proteases. The enocoded protein is primarily expressed in the Leydig and Sertoli cells of the testis and may be involved in male fertility. Alterte splicing results in multiple transcript variants.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for PRSS55 (1 products)

Catalog No. Species Pres. Purity   Source  

PRSS55 (transcript variant 2)

PRSS55 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Positive controls for PRSS55 (2 products)

Catalog No. Species Pres. Purity   Source  

PRSS55 overexpression lysate

PRSS55 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

PRSS55 overexpression lysate

PRSS55 overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.
  • LinkedIn