TA331552 DUS4L antibody

Rabbit Polyclonal Anti-DUS4L Antibody

See related secondary antibodies

Search for all "DUS4L"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish DUS4L

Product Description for DUS4L

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish DUS4L.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for DUS4L

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms tRNA-dihydrouridine synthase 4-like
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O95620
Immunogen:
The immunogen for Anti-DUS4L Antibody is: synthetic peptide directed towards the N-terminal region of Human DUS4L. Synthetic peptide located within the following region: SKLAFRTLVRKYSCDLCYTPMIVAADFVKSIKARDSEFTTNQGDCPLIVQ.
GeneID:
11062
Application WB
Background DUS4L catalyzes the synthesis of dihydrouridine, a modified base found in the D-loop of most tRs.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for DUS4L (3 products)

Catalog No. Species Pres. Purity   Source  

DUS4L (full length, N-term HIS tag)

DUS4L Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €205.00
  OriGene Technologies, Inc.

DUS4L

DUS4L Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

DUS4L

DUS4L Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.
  • LinkedIn