TA331566 ZNF598 antibody

Rabbit Polyclonal Anti-ZNF598 Antibody

See related secondary antibodies

Search for all "ZNF598"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Equine, Human, Mouse, Porcine, Rat ZNF598

Product Description for ZNF598

Rabbit anti Bovine, Equine, Human, Mouse, Porcine, Rat ZNF598.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ZNF598

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Zinc finger protein 598
Presentation Purified
Reactivity Bov, Eq, Hu, Ms, Por, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q86UK7
Immunogen:
The immunogen for Anti-ZNF598 Antibody: synthetic peptide directed towards the middle region of human ZNF598. Synthetic peptide located within the following region: EGPGPKETSTNGPVSQEAFSVTGPAAPGCVGVPGALPPPSPKLKDEDFPS.
GeneID:
90850
Application WB
Background ZNF598 contains 1 C2H2-type zinc finger and 1 RING-type zinc finger. The exact function of ZNF598 remains unknown.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ZNF598 (2 products)

Catalog No. Species Pres. Purity   Source  

ZNF598

ZNF598 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

ZNF598

ZNF598 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for ZNF598 (1 products)

Catalog No. Species Pres. Purity   Source  

ZNF598 overexpression lysate

ZNF598 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn