TA331571 Cadherin-like protein 26 antibody

Rabbit Polyclonal Anti-CDH26 Antibody

See related secondary antibodies

Search for all "Cadherin-like protein 26"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human Cadherin-like protein 26

Product Description for Cadherin-like protein 26

Rabbit anti Human Cadherin-like protein 26.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Cadherin-like protein 26

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms CDH26, Cadherin-like protein VR20
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8IXH8
Immunogen:
The immunogen for Anti-CDH26 Antibody is: synthetic peptide directed towards the middle region of Human CDH26. Synthetic peptide located within the following region: VQVTDANDPPAFHPQSFIVNKEEGARPGTLLGTFNAMDPDSQIRYELVHD.
GeneID:
60437
Application WB
Background Cadherins are a family of adhesion molecules that mediate Ca2+-dependent cell-cell adhesion in all solid tissues and modulate a wide variety of processes, including cell polarization and migration. Cadherin domains occur as repeats in the extracellular region and are thought to contribute to the sorting of heterogeneous cell types and the maintence of orderly structures such as epithelium. This gene encodes a cadherin domain-containing protein whose specific function has not yet been determined. Altertive splicing occurs at this locus and two transcript variants, encoding distinct proteins, have been identified.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Cadherin-like protein 26 (3 products)

Catalog No. Species Pres. Purity   Source  

Cadherin-like protein 26 (transcript variant a)

Cadherin-like protein 26 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Cadherin-like protein 26

Cadherin-like protein 26 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Cadherin-like protein 26

Cadherin-like protein 26 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for Cadherin-like protein 26 (1 products)

Catalog No. Species Pres. Purity   Source  

CDH26 overexpression lysate

CDH26 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn