TA331574 IFNE / Interferon epsilon antibody

Rabbit Polyclonal Anti-IFNE Antibody

See related secondary antibodies

Search for all "IFNE / Interferon epsilon"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Human, Porcine IFNE / Interferon epsilon

Product Description for IFNE / Interferon epsilon

Rabbit anti Bovine, Human, Porcine IFNE / Interferon epsilon.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for IFNE / Interferon epsilon

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms IFN-epsilon, IFNE1
Presentation Purified
Reactivity Bov, Hu, Por
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q86WN2
Immunogen:
The immunogen for Anti-IFNE Antibody is: synthetic peptide directed towards the middle region of Human IFNE. Synthetic peptide located within the following region: IFSLFRANISLDGWEENHTEKFLIQLHQQLEYLEALMGLEAEKLSGTLGS.
GeneID:
338376
Application WB
Background The function of this protein remains unknown.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for IFNE / Interferon epsilon (4 products)

Catalog No. Species Pres. Purity   Source  

IFNE / Interferon epsilon

IFNE / Interferon epsilon Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

IFNE / Interferon epsilon

IFNE / Interferon epsilon Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

IFNE / Interferon epsilon

IFNE / Interferon epsilon Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

IFNE / Interferon epsilon

IFNE / Interferon epsilon Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for IFNE / Interferon epsilon (1 products)

Catalog No. Species Pres. Purity   Source  

IFNE overexpression lysate

IFNE overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn