TA331575 DIA1R antibody

Rabbit Polyclonal Anti-CXorf36 Antibody

See related secondary antibodies

Search for all "DIA1R"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Equine, Human, Mouse DIA1R

Product Description for DIA1R

Rabbit anti Equine, Human, Mouse DIA1R.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for DIA1R

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms CXorf36, Deleted in autism-related protein 1
Presentation Purified
Reactivity Eq, Hu, Ms
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9H7Y0
Immunogen:
The immunogen for Anti-CXorf36 Antibody is: synthetic peptide directed towards the C-terminal region of Human CXorf36. Synthetic peptide located within the following region: DKQEGSQEANRAGENKDIFSCLVSGCQAQLPSCESISEKQSLVLVCQKLL.
GeneID:
79742
Application WB
Background The function of this protein remains unknown.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn