TA331582 SPDYE1 antibody

Rabbit Polyclonal Anti-SPDYE1 Antibody

See related secondary antibodies

Search for all "SPDYE1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human SPDYE1

Product Description for SPDYE1

Rabbit anti Human SPDYE1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for SPDYE1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Speedy protein E1, WBSCR19, Williams-Beuren syndrome chromosomal region 19 protein
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8NFV5
Immunogen:
The immunogen for Anti-SPDYE1 Antibody is: synthetic peptide directed towards the N-terminal region of Human SPDYE1. Synthetic peptide located within the following region: KREWSDESEEEPEKELAPEPEETWVVETLCGLKMKLKQQRVSPILLEHHK.
GeneID:
285955
Application WB
Background This gene is located at chromosome 7p13 which is close to the Williams Beuren syndrome chromosome region 7q11.23.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn