TA331587 UBR1 antibody

Rabbit Polyclonal Anti-UBR1 Antibody

See related secondary antibodies

Search for all "UBR1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Yeast UBR1

Product Description for UBR1

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Yeast UBR1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for UBR1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms E3 ubiquitin-protein ligase UBR1, N-recognin-1, Ubiquitin-protein ligase E3-alpha-1, Ubiquitin-protein ligase E3-alpha-I
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt, Ye
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8IWV7
Immunogen:
The immunogen for Anti-UBR1 Antibody: synthetic peptide directed towards the N terminal of human UBR1. Synthetic peptide located within the following region: YKQLQKEYISDDHDRSISITALSVQMFTVPTLARHLIEEQNVISVITETL.
GeneID:
197131
Application WB
Background UBR1 is an E3 ubiquitin-protein ligase which is a component of the N-end rule pathway. Recognizes and binds to proteins bearing specific N-termil residues that are destabilizing according to the N-end rule, leading to their ubiquitition and subsequent degradation. UBR1 may be involved in pancreatic homeostasis.The N-end rule pathway is one proteolytic pathway of the ubiquitin system. The recognition component of this pathway, encoded by this gene, binds to a destabilizing N-termil residue of a substrate protein and participates in the formation of a substrate-linked multiubiquitin chain. This leads to the eventual degradation of the substrate protein. The protein described in this record has a RING-type zinc finger and a UBR-type zinc finger. Mutations in this gene have been associated with Johanson-Blizzard syndrome. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additiol publications.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for UBR1 (2 products)

Catalog No. Species Pres. Purity   Source  

UBR1

UBR1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

UBR1

UBR1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for UBR1 (1 products)

Catalog No. Species Pres. Purity   Source  

UBR1 overexpression lysate

UBR1 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn