TA331591 Carboxylesterase 4A antibody

Rabbit Polyclonal Anti-CES4A Antibody

See related secondary antibodies

Search for all "Carboxylesterase 4A"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat Carboxylesterase 4A

Product Description for Carboxylesterase 4A

Rabbit anti Bovine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat Carboxylesterase 4A.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Carboxylesterase 4A

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms CES4A, CES8
Presentation Purified
Reactivity Bov, Eq, GP, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q5XG92
Immunogen:
The immunogen for Anti-CES4A Antibody is: synthetic peptide directed towards the C-terminal region of Human CES4A. Synthetic peptide located within the following region: KYWANFARTGNPNDGNLPCWPRYNKDEKYLQLDFTTRVGMKLKEKKMAFW.
GeneID:
283848
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn