TA331598 CYP4F22 antibody

Rabbit Polyclonal Anti-CYP4F22 Antibody

See related secondary antibodies

Search for all "CYP4F22"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat CYP4F22

Product Description for CYP4F22

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat CYP4F22.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for CYP4F22

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Cytochrome P450 4F22
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6NT55
Immunogen:
The immunogen for Anti-CYP4F22 Antibody is: synthetic peptide directed towards the middle region of Human CYP4F22. Synthetic peptide located within the following region: TLDSLQKCVFSYNSNCQEKMSDYISAIIELSALSVRRQYRLHHYLDFIYY.
GeneID:
126410
Application WB
Background This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygeses which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This gene is part of a cluster of cytochrome P450 genes on chromosome 19 and encodes an enzyme thought to play a role in the 12(R)-lipoxygese pathway. Mutations in this gene are the cause of ichthyosis lamellar type 3.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for CYP4F22 (3 products)

Catalog No. Species Pres. Purity   Source  

CYP4F22

CYP4F22 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

CYP4F22

CYP4F22 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

CYP4F22

CYP4F22 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for CYP4F22 (3 products)

Catalog No. Species Pres. Purity   Source  

CYP4F22 Lysate

Western Blot: CYP4F22 Lysate [NBL1-09699] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for CYP4F22
  Novus Biologicals Inc.

CYP4F22 overexpression lysate

CYP4F22 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

FLJ39501 293T Cell Transient Overexpression Lysate(Denatured)

FLJ39501 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn