TA331602 REXO1L1P antibody

Rabbit Polyclonal Anti-REXO1L1 Antibody

See related secondary antibodies

Search for all "REXO1L1P"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human REXO1L1P

Product Description for REXO1L1P

Rabbit anti Human REXO1L1P.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for REXO1L1P

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Antigen GOR homolog, GOR, Putative exonuclease GOR, REXO1L1, RNA exonuclease 1 homolog-like 1
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8IX06
Immunogen:
The immunogen for Anti-REXO1L1 Antibody is: synthetic peptide directed towards the middle region of Human REXO1L1. Synthetic peptide located within the following region: ASSSQRSRGSKVGRQPGKTRNRSGMACKTTATTSSKRIVRRASLPSLSLK.
GeneID:
254958
Application WB
Background The function of this protein remains unknown.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn