TA331604 CBWD2 antibody

Rabbit Polyclonal Anti-CBWD2 Antibody

See related secondary antibodies

Search for all "CBWD2"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat CBWD2

Product Description for CBWD2

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat CBWD2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for CBWD2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms COBW domain-containing protein 2, Cobalamin synthase W domain-containing protein 2
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8IUF1
Immunogen:
The immunogen for Anti-CBWD2 Antibody is: synthetic peptide directed towards the C-terminal region of Human CBWD2. Synthetic peptide located within the following region: TFEVPGNAKEEHLNMFIQNLLWEKNVRNKDNHCMEVIRLKGLVSIKDKSQ.
GeneID:
150472
Application WB
Background The function of this protein remains unknown.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for CBWD2 (1 products)

Catalog No. Species Pres. Purity   Source  

CBWD2 overexpression lysate

CBWD2 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn