TA331613 RNF19B antibody

Rabbit Polyclonal Anti-RNF19B Antibody

See related secondary antibodies

Search for all "RNF19B"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Equine, Human, Mouse, Porcine, Rabbit, Rat RNF19B

Product Description for RNF19B

Rabbit anti Equine, Human, Mouse, Porcine, Rabbit, Rat RNF19B.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for RNF19B

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms E3 ubiquitin-protein ligase RNF19B, IBR domain-containing protein 3, IBRDC3, NKLAM, Natural killer lytic-associated molecule, RING finger protein 19B
Presentation Purified
Reactivity Eq, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6ZMZ0
Immunogen:
The immunogen for Anti-RNF19B Antibody is: synthetic peptide directed towards the C-terminal region of Human RNF19B. Synthetic peptide located within the following region: VHAQMAENEEEGSGGGGSEEDPPCRHQSCEQKDCLASKPWDISLAQPESI.
GeneID:
127544
Application WB
Background IBRDC3 is a cytolysis-associated transmembrane protein expressed in tural killer (NK) cells and T lymphocytes following cytokine stimulation.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn