TA331616 TTLL10 antibody

Rabbit Polyclonal Anti-TTLL10 Antibody

See related secondary antibodies

Search for all "TTLL10"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Rat, Yeast TTLL10

Product Description for TTLL10

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Rat, Yeast TTLL10.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for TTLL10

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Inactive polyglycylase TTLL10, Tubulin--tyrosine ligase-like protein 10
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Rt, Ye
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6ZVT0
Immunogen:
The immunogen for Anti-TTLL10 Antibody is: synthetic peptide directed towards the N-terminal region of Human TTLL10. Synthetic peptide located within the following region: ATIISSYCKSKGWQRIHDSRRDDYTLKWCEVKSRDSYGSFREGEQLLYQL.
GeneID:
254173
Application WB
Background TTLL10 ictive polyglycylase.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for TTLL10 (2 products)

Catalog No. Species Pres. Purity   Source  

TTLL10 overexpression lysate

TTLL10 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

TTLL10 overexpression lysate

TTLL10 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn