TA331627 TARSL2 antibody

Rabbit Polyclonal Anti-TARSL2 Antibody

See related secondary antibodies

Search for all "TARSL2"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish TARSL2

Product Description for TARSL2

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish TARSL2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for TARSL2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Probable threonyl-tRNA synthetase 2, ThrRS, Threonine--tRNA ligase, Threonyl-tRNA synthetase-like protein 2, cytoplasmic
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
A2RTX5
Immunogen:
The immunogen for Anti-TARSL2 Antibody is: synthetic peptide directed towards the C-terminal region of Human TARSL2. Synthetic peptide located within the following region: TYVSKDGDDKKRPVIIHRAILGSVERMIAILSENYGGKWPFWLSPRQVMV.
GeneID:
123283
Application WB
Background The function of this protein remains unknown.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn