TA331629 ZFP276 antibody

Rabbit Polyclonal Anti-ZNF276 Antibody

See related secondary antibodies

Search for all "ZFP276"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human ZFP276

Product Description for ZFP276

Rabbit anti Human ZFP276.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ZFP276

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms ZNF276, Zfp-276, Zinc finger protein 276
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8N554
Immunogen:
The immunogen for Anti-ZNF276 Antibody: synthetic peptide directed towards the middle region of human ZNF276. Synthetic peptide located within the following region: SALAVKWPWDKETAPRLPQHRGWNPGDAPQTSQGRGTGTPVGAETKTLPS.
GeneID:
92822
Application WB
Background The exact function of this protein remains unknown.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ZFP276 (4 products)

Catalog No. Species Pres. Purity   Source  

ZFP276

ZFP276 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ZFP276

ZFP276 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ZFP276

ZFP276 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ZFP276

ZFP276 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for ZFP276 (1 products)

Catalog No. Species Pres. Purity   Source  

ZNF276 293T Cell Transient Overexpression Lysate(Denatured)

ZNF276 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn