TA331630 C12orf65 antibody

Rabbit Polyclonal Anti-C12orf65 Antibody

See related secondary antibodies

Search for all "C12orf65"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rat C12orf65

Product Description for C12orf65

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rat C12orf65.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for C12orf65

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms FLJ38663, Probable peptide chain release factor C12orf65
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9H3J6
Immunogen:
The immunogen for Anti-C12orf65 Antibody is: synthetic peptide directed towards the C-terminal region of Human C12orf65. Synthetic peptide located within the following region: HIPSGIVVKCHQTRSVDQNRKLARKILQEKVDVFYNGENSPVHKEKREAA.
GeneID:
91574
Application WB
Background This nuclear gene encodes a mitochondrial matrix protein that appears to contribute to peptide chain termition in the mitochondrial translation machinery. Two different 1 bp deletions (resulting in the same premature stop codon)result in decreased mitochondrial translation, decreased levels of oxidative phosphorylation complexes and encepthalomyopathy. Altertive splicing results in multiple transcript variants.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for C12orf65 (3 products)

Catalog No. Species Pres. Purity   Source  

C12orf65 (transcript variant 1)

C12orf65 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

C12orf65

C12orf65 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

C12orf65

C12orf65 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for C12orf65 (3 products)

Catalog No. Species Pres. Purity   Source  

C12orf65 Lysate

C12orf65 Lysate Protein
  Novus Biologicals Inc.

C12orf65 overexpression lysate

C12orf65 overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.

FLJ38663 293T Cell Transient Overexpression Lysate(Denatured)

FLJ38663 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn